PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0131000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 260aa    MW: 28600.1 Da    PI: 7.588
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0131000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-1866111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd +l ++v ++G ++W++Iar ++ gRt+k+c++rw + 
   Spipo0G0131000  66 KGPWSPEEDVILSRLVSKFGARNWSLIARGIP-GRTGKSCRLRWCNQ 111
                      79******************************.***********985 PP

2Myb_DNA-binding57.43.2e-18118162147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+eEd ++v a++ +G++ W++Iar +  gRt++ +k++w++ 
   Spipo0G0131000 118 RQPFTEEEDRIIVAAHAVHGNK-WASIARLLE-GRTDNAIKNHWNST 162
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.52861112IPR017930Myb domain
SuperFamilySSF466892.48E-3163159IPR009057Homeodomain-like
SMARTSM007176.6E-1665114IPR001005SANT/Myb domain
PfamPF002491.2E-1766111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2767119IPR009057Homeodomain-like
CDDcd001671.54E-1468110No hitNo description
PROSITE profilePS5129428.236113167IPR017930Myb domain
SMARTSM007172.5E-16117165IPR001005SANT/Myb domain
PfamPF002492.8E-15118162IPR001005SANT/Myb domain
CDDcd001679.92E-12120163No hitNo description
Gene3DG3DSA:1.10.10.604.2E-24120166IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MVSVTSRYGP LGKSHTEKGK MWSNGLEEIG RRAHNGPIHD GFWANFSGED GETLVSCWGL  60
GEDRVKGPWS PEEDVILSRL VSKFGARNWS LIARGIPGRT GKSCRLRWCN QLDPTVKRQP  120
FTEEEDRIIV AAHAVHGNKW ASIARLLEGR TDNAIKNHWN STLKRRCVEA GKPRNAALEE  180
VRVSSEDGLS FGEASSFSPS QEVASGSSLL GPEFVEYAEE TAVPGLEVAS IARDLSSAAW  240
MRSSFTAEVM PRLWNHSPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-41631674108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256736.13e-71PREDICTED: uncharacterized protein LOC104597048 isoform X1
RefseqXP_014515157.13e-71PREDICTED: transcriptional activator Myb
TrEMBLA0A0S3SWF33e-71A0A0S3SWF3_PHAAN; Uncharacterized protein
STRINGVIT_08s0007g01540.t013e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89903647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.16e-58myb domain protein 109